SCOPe 2.07: Domain d5b1ap_: 5b1a P:

Lineage for d5b1ap_ (5b1a P:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries)

8. Domain d5b1ap_: 5b1a P: [322557]
   Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1aq_, d5b1ar_, d5b1as_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_
   automated match to d1v54c_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d5b1ap_

PDB Entry: 5b1a, 1.5 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution

PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5b1ap_:

Sequence; same for both SEQRES and ATOM records:

>d5b1ap_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d5b1ap_:

• d5b1ap_ first appeared in SCOPe 2.06
  
• d5b1ap_ appears in the current release, SCOPe 2.08