![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein automated matches [190381] (11 species) not a true protein |
![]() | Species Escherichia coli [TaxId:634468] [322555] (1 PDB entry) |
![]() | Domain d5g3lh_: 5g3l H: [322556] Other proteins in same PDB: d5g3lf_, d5g3lg_ automated match to d1qb5d_ complexed with na, sia |
PDB Entry: 5g3l (more details), 1.72 Å
SCOPe Domain Sequences for d5g3lh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g3lh_ b.40.2.1 (H:) automated matches {Escherichia coli [TaxId: 634468]} gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm taemrkiaxaavlsgmrvnmcaspasspnviwaieleae
Timeline for d5g3lh_:
![]() Domains from other chains: (mouse over for more information) d5g3ld_, d5g3le_, d5g3lf_, d5g3lg_ |