![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins) automatically mapped to Pfam PF04300 |
![]() | Protein automated matches [190275] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187067] (3 PDB entries) |
![]() | Domain d5b4nb_: 5b4n B: [322550] automated match to d2e33a_ mutant |
PDB Entry: 5b4n (more details), 2.3 Å
SCOPe Domain Sequences for d5b4nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b4nb_ b.18.1.21 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rnllrnpcgeedlegwsldvnggdgwkveelsrdqrkefpndqvkkyfvtsyytcrkaqv idlqaegyweelldttqpaivvkdwysgrpdcgskyqltvrllsenedvlaefqpdpati qqksdakwreishtfidygpgvrfvrfehggvdthywagwygprvtnssvwvep
Timeline for d5b4nb_: