SCOPe 2.08: Domain d5b4nb_: 5b4n B:

Lineage for d5b4nb_ (5b4n B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
   automatically mapped to Pfam PF04300

6. Protein automated matches [190275] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187067] (3 PDB entries)

8. Domain d5b4nb_: 5b4n B: [322550]
   automated match to d2e33a_
   mutant

Details for d5b4nb_

PDB Entry: 5b4n, 2.3 Å

PDB Description: structure analysis of function associated loop mutant of substrate recognition domain of fbs1 ubiquitin ligase

PDB Compounds: (B:) F-box only protein 2

SCOPe Domain Sequences for d5b4nb_:

Sequence; same for both SEQRES and ATOM records:

>d5b4nb_ b.18.1.21 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rnllrnpcgeedlegwsldvnggdgwkveelsrdqrkefpndqvkkyfvtsyytcrkaqv
idlqaegyweelldttqpaivvkdwysgrpdcgskyqltvrllsenedvlaefqpdpati
qqksdakwreishtfidygpgvrfvrfehggvdthywagwygprvtnssvwvep

Timeline for d5b4nb_:

• d5b4nb_ first appeared in SCOPe 2.06
  
• d5b4nb_ appears in SCOPe 2.07