Lineage for d5d1zc2 (5d1z C:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752292Domain d5d1zc2: 5d1z C:108-214 [322547]
    Other proteins in same PDB: d5d1za1, d5d1zc1, d5d1ze1, d5d1zh1, d5d1zi_, d5d1zj_
    automated match to d1dn0a2

Details for d5d1zc2

PDB Entry: 5d1z (more details), 3.17 Å

PDB Description: isdb neat1 bound by clone d4-10
PDB Compounds: (C:) D4-10 Light Chain

SCOPe Domain Sequences for d5d1zc2:

Sequence, based on SEQRES records: (download)

>d5d1zc2 b.1.1.2 (C:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Sequence, based on observed residues (ATOM records): (download)

>d5d1zc2 b.1.1.2 (C:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskds
tyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5d1zc2:

Click to download the PDB-style file with coordinates for d5d1zc2.
(The format of our PDB-style files is described here.)

Timeline for d5d1zc2: