Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Heat-labile toxin [50205] (2 species) |
Species Escherichia coli, type IIB [TaxId:562] [50207] (4 PDB entries) |
Domain d5g3lf_: 5g3l F: [322545] Other proteins in same PDB: d5g3ld_, d5g3le_, d5g3lh_ automated match to d1qb5d_ complexed with na, sia |
PDB Entry: 5g3l (more details), 1.72 Å
SCOPe Domain Sequences for d5g3lf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g3lf_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IIB [TaxId: 562]} gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm taemrkiamaavlsgmrvnmcaspasspnviwaieleae
Timeline for d5g3lf_:
View in 3D Domains from other chains: (mouse over for more information) d5g3ld_, d5g3le_, d5g3lg_, d5g3lh_ |