SCOPe 2.08: Domain d1g5pb_: 1g5p B:

Lineage for d1g5pb_ (1g5p B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (26 PDB entries)

8. Domain d1g5pb_: 1g5p B: [32254]
   complexed with sf4

Details for d1g5pb_

PDB Entry: 1g5p, 2.2 Å

PDB Description: nitrogenase iron protein from azotobacter vinelandii

PDB Compounds: (B:) nitrogenase iron protein

SCOPe Domain Sequences for d1g5pb_:

Sequence; same for both SEQRES and ATOM records:

>d1g5pb_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

Timeline for d1g5pb_:

• d1g5pb_ first appeared (with stable ids) in SCOP 1.55
  
• d1g5pb_ appears in SCOPe 2.07