Lineage for d5ebgb_ (5ebg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742196Species Cow (Bos taurus) [TaxId:9913] [197337] (3 PDB entries)
  8. 2742198Domain d5ebgb_: 5ebg B: [322536]
    automated match to d2q3ab_

Details for d5ebgb_

PDB Entry: 5ebg (more details), 1.8 Å

PDB Description: crystal structure of bovine cd8aa homodimer
PDB Compounds: (B:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d5ebgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ebgb_ b.1.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lsfrmsptqketrlgekvelqcellqsgmatgcswlrhipgddprptflmylsaqrvkla
egldprhisgakvsgtkfqltlssflqedqgyyfcsvvsnsilyfsnfvpvflp

SCOPe Domain Coordinates for d5ebgb_:

Click to download the PDB-style file with coordinates for d5ebgb_.
(The format of our PDB-style files is described here.)

Timeline for d5ebgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ebga_