SCOPe 2.07: Domain d5dpqb_: 5dpq B:

Lineage for d5dpqb_ (5dpq B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)

8. Domain d5dpqb_: 5dpq B: [322534]
   automated match to d4zcbb_
   complexed with act; mutant

Details for d5dpqb_

PDB Entry: 5dpq, 1.78 Å

PDB Description: crystal structure of e72a mutant of domain swapped dimer human cellular retinol binding protein

PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d5dpqb_:

Sequence; same for both SEQRES and ATOM records:

>d5dpqb_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrny
dvdftvgvefdaytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylelt
cgdqvcrqvfkkk

Timeline for d5dpqb_:

• d5dpqb_ first appeared in SCOPe 2.06
  
• d5dpqb_ appears in the current release, SCOPe 2.08