| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [260458] (12 PDB entries) |
| Domain d5g3na1: 5g3n A:1-124 [322528] Other proteins in same PDB: d5g3na2, d5g3nb2 automated match to d1n29a_ complexed with ca, fmt, x28 |
PDB Entry: 5g3n (more details), 1.8 Å
SCOPe Domain Sequences for d5g3na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g3na1 a.133.1.2 (A:1-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg
tkflsykfsnsgsriscakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
tprc
Timeline for d5g3na1: