Lineage for d5g3na1 (5g3n A:1-124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2339218Protein automated matches [190139] (26 species)
    not a true protein
  7. 2339311Species Human (Homo sapiens) [TaxId:9606] [260458] (11 PDB entries)
  8. 2339312Domain d5g3na1: 5g3n A:1-124 [322528]
    Other proteins in same PDB: d5g3na2, d5g3nb2
    automated match to d1n29a_
    complexed with ca, fmt, x28

Details for d5g3na1

PDB Entry: 5g3n (more details), 1.8 Å

PDB Description: discovery of a novel secreted phospholipase a2 (spla2) inhibitor.
PDB Compounds: (A:) Phospholipase A2, membrane associated

SCOPe Domain Sequences for d5g3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g3na1 a.133.1.2 (A:1-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg
tkflsykfsnsgsriscakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
tprc

SCOPe Domain Coordinates for d5g3na1:

Click to download the PDB-style file with coordinates for d5g3na1.
(The format of our PDB-style files is described here.)

Timeline for d5g3na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g3na2