![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
![]() | Family d.110.1.0: automated matches [191571] (1 protein) not a true family |
![]() | Protein automated matches [190990] (3 species) not a true protein |
![]() | Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [322517] (3 PDB entries) |
![]() | Domain d5fegb_: 5feg B: [322518] automated match to d1f2ka_ |
PDB Entry: 5feg (more details), 2.8 Å
SCOPe Domain Sequences for d5fegb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fegb_ d.110.1.0 (B:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} swqayvddhlmceiegnhlsaaaiigqdgsvwaqsanfpqfkseeitgimsdfhepgtla ptglyiggtkymviqgepgavirgkkgpggvtvkktnqaliigiydepmtpgqcnmiver lgdylidqgy
Timeline for d5fegb_: