SCOPe 2.08: Domain d5fegb_: 5feg B:

Lineage for d5fegb_ (5feg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.0: automated matches [191571] (1 protein)
   not a true family

6. Protein automated matches [190990] (3 species)
   not a true protein

7. Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [322517] (3 PDB entries)

8. Domain d5fegb_: 5feg B: [322518]
   automated match to d1f2ka_

Details for d5fegb_

PDB Entry: 5feg, 2.8 Å

PDB Description: crystal structure of the dimeric allergen profilin (hev b 8)

PDB Compounds: (B:) profilin-2

SCOPe Domain Sequences for d5fegb_:

Sequence; same for both SEQRES and ATOM records:

>d5fegb_ d.110.1.0 (B:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
swqayvddhlmceiegnhlsaaaiigqdgsvwaqsanfpqfkseeitgimsdfhepgtla
ptglyiggtkymviqgepgavirgkkgpggvtvkktnqaliigiydepmtpgqcnmiver
lgdylidqgy

Timeline for d5fegb_:

• d5fegb_ first appeared in SCOPe 2.06
  
• d5fegb_ appears in SCOPe 2.07