Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries) |
Domain d5etjc1: 5etj C:1-286 [322511] Other proteins in same PDB: d5etja2, d5etjb2, d5etjc2, d5etjd2, d5etje2, d5etjf2 automated match to d1ulba_ complexed with im5, po4; mutant |
PDB Entry: 5etj (more details), 2.3 Å
SCOPe Domain Sequences for d5etjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5etjc1 c.56.2.1 (C:1-286) automated matches {Human (Homo sapiens) [TaxId: 9606]} mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl itnkvimdyeslekanhdevaaagkqaaqkleqfvsilmasiplpd
Timeline for d5etjc1: