Lineage for d5dg2b_ (5dg2 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2389129Protein automated matches [190029] (5 species)
    not a true protein
  7. 2389137Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)
  8. 2389151Domain d5dg2b_: 5dg2 B: [322506]
    automated match to d1hlca_
    complexed with gal, glc

Details for d5dg2b_

PDB Entry: 5dg2 (more details), 1.61 Å

PDB Description: sugar binding protein - human galectin-2 (dimer)
PDB Compounds: (B:) galectin-2

SCOPe Domain Sequences for d5dg2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dg2b_ b.29.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
ggfnmssfklk

SCOPe Domain Coordinates for d5dg2b_:

Click to download the PDB-style file with coordinates for d5dg2b_.
(The format of our PDB-style files is described here.)

Timeline for d5dg2b_: