SCOPe 2.06: Domain d5dg2b_: 5dg2 B:

Lineage for d5dg2b_ (5dg2 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (9 PDB entries)

8. Domain d5dg2b_: 5dg2 B: [322506]
   automated match to d1hlca_
   complexed with gal, glc

Details for d5dg2b_

PDB Entry: 5dg2, 1.61 Å

PDB Description: sugar binding protein - human galectin-2 (dimer)

PDB Compounds: (B:) galectin-2

SCOPe Domain Sequences for d5dg2b_:

Sequence; same for both SEQRES and ATOM records:

>d5dg2b_ b.29.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
ggfnmssfklk

Timeline for d5dg2b_:

• d5dg2b_ is new in SCOPe 2.06-stable
  
• d5dg2b_ appears in SCOPe 2.07
  
• d5dg2b_ appears in the current release, SCOPe 2.08