Lineage for d5ddna_ (5ddn A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162749Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)
  7. 2162763Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (27 PDB entries)
  8. 2162783Domain d5ddna_: 5ddn A: [322493]
    Other proteins in same PDB: d5ddnb_
    automated match to d1pb7a_
    complexed with 5dx, gly

Details for d5ddna_

PDB Entry: 5ddn (more details), 2.11 Å

PDB Description: crystal structure of glun1/glun2a nmda receptor agonist binding domains with glycine and antagonist, 4-bromophenyl-acepc
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5ddna_:

Sequence, based on SEQRES records: (download)

>d5ddna_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvry

Sequence, based on observed residues (ATOM records): (download)

>d5ddna_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgptvpqccygfcidllikl
artmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivapltinneraqyief
skpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrh
mekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrkd
spwkqnvslsilkshengfmedldktwvry

SCOPe Domain Coordinates for d5ddna_:

Click to download the PDB-style file with coordinates for d5ddna_.
(The format of our PDB-style files is described here.)

Timeline for d5ddna_:

  • d5ddna_ is new in SCOPe 2.06-stable
  • d5ddna_ does not appear in SCOPe 2.07