Lineage for d5dfth_ (5dft H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762347Domain d5dfth_: 5dft H: [322491]
    automated match to d1j8ka_
    complexed with cit

Details for d5dfth_

PDB Entry: 5dft (more details), 2.5 Å

PDB Description: structure of the eleventh type iii domain from human fibronectin
PDB Compounds: (H:) Fibronectin

SCOPe Domain Sequences for d5dfth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dfth_ b.1.2.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmqvtdvqdnsisvkwlpssspvtgyrvtttpkngpgptktktagpdqtemtieglqptv
eyvvsvyaqnpsgesqplvqtavttipa

SCOPe Domain Coordinates for d5dfth_:

Click to download the PDB-style file with coordinates for d5dfth_.
(The format of our PDB-style files is described here.)

Timeline for d5dfth_: