| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) ![]() |
| Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
| Protein Cytochrome c oxidase subunit h [47696] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47697] (19 PDB entries) |
| Domain d5b1bu_: 5b1b U: [322490] Other proteins in same PDB: d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bi_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bv_, d5b1bw_, d5b1bx_, d5b1by_, d5b1bz_ automated match to d1v54h_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5b1b (more details), 1.6 Å
SCOPe Domain Sequences for d5b1bu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1bu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki
Timeline for d5b1bu_:
View in 3DDomains from other chains: (mouse over for more information) d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bh_, d5b1bi_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bv_, d5b1bw_, d5b1bx_, d5b1by_, d5b1bz_ |