Lineage for d1g20f_ (1g20 F:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122260Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 122360Protein Nitrogenase iron protein [52661] (2 species)
  7. 122361Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)
  8. 122367Domain d1g20f_: 1g20 F: [32248]
    Other proteins in same PDB: d1g20a_, d1g20b_, d1g20c_, d1g20d_

Details for d1g20f_

PDB Entry: 1g20 (more details), 2.2 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
PDB Compounds: (F:)

SCOP Domain Sequences for d1g20f_:

Sequence, based on SEQRES records: (download)

>d1g20f_ c.37.1.10 (F:) Nitrogenase iron protein {Azotobacter vinelandii}
mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
larkvvdnkllvipnpitmdeleellmef

Sequence, based on observed residues (ATOM records): (download)

>d1g20f_ c.37.1.10 (F:) Nitrogenase iron protein {Azotobacter vinelandii}
mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilntimemaaeagt
vedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldfvfydv
gdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgglicnsr
edeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyralarkvvdnk
llvipnpitmdeleellmef

SCOP Domain Coordinates for d1g20f_:

Click to download the PDB-style file with coordinates for d1g20f_.
(The format of our PDB-style files is described here.)

Timeline for d1g20f_: