Lineage for d5de4b_ (5de4 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163929Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)
  8. 2164097Domain d5de4b_: 5de4 B: [322469]
    Other proteins in same PDB: d5de4a_
    automated match to d4nf8b_
    complexed with 5dz, gly, peg

Details for d5de4b_

PDB Entry: 5de4 (more details), 2.4 Å

PDB Description: crystal structure of glun1/glun2a nmda receptor agonist binding domains with glycine and antagonist, 4-fluorophenyl-acepc
PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5de4b_:

Sequence, based on SEQRES records: (download)

>d5de4b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgy
gialqkgspwkrqidlallqfvgdgemeeletlwltgich

Sequence, based on observed residues (ATOM records): (download)

>d5de4b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltcvrntvpcrkfvkinnstnegmnvkkcckgfcidil
kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf
svpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
alqkgspwkrqidlallqfvgdgemeeletlwltgich

SCOPe Domain Coordinates for d5de4b_:

Click to download the PDB-style file with coordinates for d5de4b_.
(The format of our PDB-style files is described here.)

Timeline for d5de4b_:

  • d5de4b_ is new in SCOPe 2.06-stable
  • d5de4b_ does not appear in SCOPe 2.07