SCOP 1.59: Domain d1fp6c_: 1fp6 C:

Lineage for d1fp6c_ (1fp6 C:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)

8. Domain d1fp6c_: 1fp6 C: [32245]

Details for d1fp6c_

PDB Entry: 1fp6, 2.15 Å

PDB Description: the nitrogenase fe protein from azotobacter vinelandii complexed with mgadp

SCOP Domain Sequences for d1fp6c_:

Sequence; same for both SEQRES and ATOM records:

>d1fp6c_ c.37.1.10 (C:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkt

Timeline for d1fp6c_:

• d1fp6c_ first appeared (with stable ids) in SCOP 1.55
  
• d1fp6c_ appears in SCOP 1.57
  
• d1fp6c_ appears in SCOP 1.61
  
• d1fp6c_ appears in the current release, SCOPe 2.08