| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries) |
| Domain d5k3jb3: 5k3j B:475-661 [322445] Other proteins in same PDB: d5k3ja1, d5k3ja4, d5k3jb1, d5k3jb4 automated match to d2ddha2 complexed with 6qa, atp, fad, mg |
PDB Entry: 5k3j (more details), 2.68 Å
SCOPe Domain Sequences for d5k3jb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3jb3 a.29.3.0 (B:475-661) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
tdltslngyvkmfenmarrqawkatekflklmesgesrevawnksaveltrasrlhtrlf
iieafmrrvsriedipvkevltdllhlhvnyelldvatyalefmsftqldyvrdqlylyl
ekirpnavslvdsfqisdmqlrsvlgrrdghvyenlfkwakssplnnadvlpsvekylkp
mmekakl
Timeline for d5k3jb3:
View in 3DDomains from other chains: (mouse over for more information) d5k3ja1, d5k3ja2, d5k3ja3, d5k3ja4 |