SCOP 1.69: Domain d1fp6b_: 1fp6 B:

Lineage for d1fp6b_ (1fp6 B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (12 PDB entries)

8. Domain d1fp6b_: 1fp6 B: [32244]

Details for d1fp6b_

PDB Entry: 1fp6, 2.15 Å

PDB Description: the nitrogenase fe protein from azotobacter vinelandii complexed with mgadp

SCOP Domain Sequences for d1fp6b_:

Sequence; same for both SEQRES and ATOM records:

>d1fp6b_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

Timeline for d1fp6b_:

• d1fp6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fp6b_ appears in SCOP 1.67
  
• d1fp6b_ appears in SCOP 1.71
  
• d1fp6b_ appears in the current release, SCOPe 2.08