Lineage for d1fp6b_ (1fp6 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69969Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 70064Protein Nitrogenase iron protein [52661] (2 species)
  7. 70065Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)
  8. 70067Domain d1fp6b_: 1fp6 B: [32244]

Details for d1fp6b_

PDB Entry: 1fp6 (more details), 2.15 Å

PDB Description: the nitrogenase fe protein from azotobacter vinelandii complexed with mgadp

SCOP Domain Sequences for d1fp6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp6b_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOP Domain Coordinates for d1fp6b_:

Click to download the PDB-style file with coordinates for d1fp6b_.
(The format of our PDB-style files is described here.)

Timeline for d1fp6b_: