Lineage for d1fp6a_ (1fp6 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 582486Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 582637Protein Nitrogenase iron protein [52661] (2 species)
  7. 582638Species Azotobacter vinelandii [TaxId:354] [52662] (12 PDB entries)
  8. 582639Domain d1fp6a_: 1fp6 A: [32243]

Details for d1fp6a_

PDB Entry: 1fp6 (more details), 2.15 Å

PDB Description: the nitrogenase fe protein from azotobacter vinelandii complexed with mgadp

SCOP Domain Sequences for d1fp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp6a_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOP Domain Coordinates for d1fp6a_:

Click to download the PDB-style file with coordinates for d1fp6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fp6a_: