Lineage for d4zmtb2 (4zmt B:102-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763541Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)
  8. 2763582Domain d4zmtb2: 4zmt B:102-215 [322428]
    automated match to d1ff5a2
    complexed with ca

Details for d4zmtb2

PDB Entry: 4zmt (more details), 2.7 Å

PDB Description: crystal structure of human p-cadherin (ss-x-dimer-long)
PDB Compounds: (B:) Cadherin-3

SCOPe Domain Sequences for d4zmtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zmtb2 b.1.6.0 (B:102-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl
mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveildan

SCOPe Domain Coordinates for d4zmtb2:

Click to download the PDB-style file with coordinates for d4zmtb2.
(The format of our PDB-style files is described here.)

Timeline for d4zmtb2: