Lineage for d4zora_ (4zor A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569071Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2569072Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2569073Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2569122Protein MS2 virus coat protein [55407] (1 species)
  7. 2569123Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2569200Domain d4zora_: 4zor A: [322411]
    automated match to d2bu1a_
    complexed with po4

Details for d4zora_

PDB Entry: 4zor (more details), 2.2 Å

PDB Description: the structure of the s37p ms2 viral capsid assembly.
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d4zora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zora_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
snftqfvlvdnggtgdvtvapsnfangvaewissnprsqaykvtcsvrqssaqnrkytik
vevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpipsa
iaansgiy

SCOPe Domain Coordinates for d4zora_:

Click to download the PDB-style file with coordinates for d4zora_.
(The format of our PDB-style files is described here.)

Timeline for d4zora_: