Lineage for d1dj3b_ (1dj3 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126015Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2126016Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 2126063Species Wheat (Triticum aestivum) [TaxId:4565] [52658] (1 PDB entry)
  8. 2126065Domain d1dj3b_: 1dj3 B: [32240]
    complexed with gdp

Details for d1dj3b_

PDB Entry: 1dj3 (more details), 3 Å

PDB Description: structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana
PDB Compounds: (B:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1dj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj3b_ c.37.1.10 (B:) Adenylosuccinate synthetase, PurA {Wheat (Triticum aestivum) [TaxId: 4565]}
adrvsslsnvsgvlgsqwgdegkgklvdvlaprfdivarcqgganaghtiynsegkkfal
hlvpsgilhegtlcvvgngavihvpgffgeidglqsngvscdgrilvsdrahllfdlhqt
vdglreaelansfigttkrgigpcysskvtrnglrvcdlrhmdtfgdkldvlfedaaarf
egfkyskgmlkeeverykkfaerlepfiadtvhvlnesirqkkkilveggqatmldidfg
typfvtssspsaggictglgiaprvigdligvvkayttrvgsgpfptellgeegdvlrka
gmefgtttgrprrcgwldivalkyccdingfsslnltkldvlsglpeiklgvsynqmdge
klqsfpgdldtleqvqvnyevlpgwdsdissvrsyselpqaarryverieelagvpvhyi
gvgpgrdaliyk

SCOPe Domain Coordinates for d1dj3b_:

Click to download the PDB-style file with coordinates for d1dj3b_.
(The format of our PDB-style files is described here.)

Timeline for d1dj3b_: