![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
![]() | Protein automated matches [190458] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries) |
![]() | Domain d4zmxa2: 4zmx A:102-213 [322391] automated match to d4oy9a2 complexed with ca |
PDB Entry: 4zmx (more details), 3.1 Å
SCOPe Domain Sequences for d4zmxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zmxa2 b.1.6.0 (A:102-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveild
Timeline for d4zmxa2: