SCOPe 2.08: Domain d4zmxa1: 4zmx A:4-101

Lineage for d4zmxa1 (4zmx A:4-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)

8. Domain d4zmxa1: 4zmx A:4-101 [322390]
   automated match to d4oy9a1
   complexed with ca

Details for d4zmxa1

PDB Entry: 4zmx, 3.1 Å

PDB Description: crystal structure of human p-cadherin (int-x-dimer)

PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d4zmxa1:

Sequence, based on SEQRES records:

>d4zmxa1 b.1.6.0 (A:4-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwllln
kpldreeiakyelfghavsengasvedpmnisiivtdq

Sequence, based on observed residues (ATOM records):

>d4zmxa1 b.1.6.0 (A:4-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vapisvpengkgpfpqrlnqlkifysitgpgadsppegvfaveketgwlllnkpldreei
akyelfghdpmnisiivtdq

Timeline for d4zmxa1:

• d4zmxa1 first appeared in SCOPe 2.06
  
• d4zmxa1 appears in SCOPe 2.07