Lineage for d4zmna2 (4zmn A:102-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037296Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2037297Protein automated matches [190458] (4 species)
    not a true protein
  7. 2037312Species Human (Homo sapiens) [TaxId:9606] [255601] (16 PDB entries)
  8. 2037343Domain d4zmna2: 4zmn A:102-213 [322385]
    automated match to d1ff5a2
    complexed with ca, gol

Details for d4zmna2

PDB Entry: 4zmn (more details), 2.6 Å

PDB Description: crystal structure of human p-cadherin (ss-dimer long)
PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d4zmna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zmna2 b.1.6.0 (A:102-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl
mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveild

SCOPe Domain Coordinates for d4zmna2:

Click to download the PDB-style file with coordinates for d4zmna2.
(The format of our PDB-style files is described here.)

Timeline for d4zmna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zmna1