SCOPe 2.08: Domain d4zmna1: 4zmn A:1-101

Lineage for d4zmna1 (4zmn A:1-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)

8. Domain d4zmna1: 4zmn A:1-101 [322384]
   automated match to d1ff5a1
   complexed with ca, gol

Details for d4zmna1

PDB Entry: 4zmn, 2.6 Å

PDB Description: crystal structure of human p-cadherin (ss-dimer long)

PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d4zmna1:

Sequence; same for both SEQRES and ATOM records:

>d4zmna1 b.1.6.0 (A:1-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwl
llnkpldreeiakyelfghavsengasvedpmnisiivtdq

Timeline for d4zmna1:

• d4zmna1 first appeared in SCOPe 2.06
  
• d4zmna1 appears in SCOPe 2.07