Lineage for d1dj2b_ (1dj2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111792Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 2111836Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52657] (1 PDB entry)
  8. 2111838Domain d1dj2b_: 1dj2 B: [32238]
    complexed with gdp

Details for d1dj2b_

PDB Entry: 1dj2 (more details), 2.9 Å

PDB Description: structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana
PDB Compounds: (B:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1dj2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj2b_ c.37.1.10 (B:) Adenylosuccinate synthetase, PurA {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
igslsqvsgvlgcqwgdegkgklvdilaqhfdivarcqgganaghtiynsegkkfalhlv
psgilnedttcvigngvvvhlpglfkeidglesngvsckgrilvsdrahllfdfhqevdg
lreselaksfigttkrgigpaysskvirngirvgdlrhmdtlpqkldlllsdaaarfqgf
kytpemlreeveaykryadrlepyitdtvhfindsisqkkkvlveggqatmldidfgtyp
fvtssspsaggictglgiapsvvgdligvvkayttrvgsgpfptenlgtggdllrlagqe
fgtttgrprrcgwldivalkfscqingfaslnltkldvlsdlneiqlgvaykrsdgtpvk
sfpgdlrlleelhveyevlpgwksdissvrnysdlpkaaqqyverieelvgvpihyigig
pgrdaliyk

SCOPe Domain Coordinates for d1dj2b_:

Click to download the PDB-style file with coordinates for d1dj2b_.
(The format of our PDB-style files is described here.)

Timeline for d1dj2b_: