| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
| Protein automated matches [190458] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries) |
| Domain d4zmqb1: 4zmq B:1-101 [322374] Other proteins in same PDB: d4zmqa3, d4zmqb3 automated match to d1ff5a1 complexed with 1pe, ca |
PDB Entry: 4zmq (more details), 2.2 Å
SCOPe Domain Sequences for d4zmqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zmqb1 b.1.6.0 (B:1-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwl
llnkpldreeiakyelfghavsengasvedpmnisiivtdq
Timeline for d4zmqb1: