Lineage for d1dj2a_ (1dj2 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23416Protein Adenylosuccinate synthetase, PurA [52655] (3 species)
  7. 23446Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52657] (1 PDB entry)
  8. 23447Domain d1dj2a_: 1dj2 A: [32237]

Details for d1dj2a_

PDB Entry: 1dj2 (more details), 2.9 Å

PDB Description: structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana

SCOP Domain Sequences for d1dj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj2a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Mouse-ear cress (Arabidopsis thaliana)}
igslsqvsgvlgcqwgdegkgklvdilaqhfdivarcqgganaghtiynsegkkfalhlv
psgilnedttcvigngvvvhlpglfkeidglesngvsckgrilvsdrahllfdfhqevdg
lreselaksfigttkrgigpaysskvirngirvgdlrhmdtlpqkldlllsdaaarfqgf
kytpemlreeveaykryadrlepyitdtvhfindsisqkkkvlveggqatmldidfgtyp
fvtssspsaggictglgiapsvvgdligvvkayttrvgsgpfptenlgtggdllrlagqe
fgtttgrprrcgwldivalkfscqingfaslnltkldvlsdlneiqlgvaykrsdgtpvk
sfpgdlrlleelhveyevlpgwksdissvrnysdlpkaaqqyverieelvgvpihyigig
pgrdaliyk

SCOP Domain Coordinates for d1dj2a_:

Click to download the PDB-style file with coordinates for d1dj2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dj2a_: