Lineage for d1dj2a_ (1dj2 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52657] (1 PDB entry)
  8. Domain d1dj2a_: 1dj2 A: [32237]
    complexed with gdp

Details for d1dj2a_

PDB Entry: 1dj2 (more details), 2.9 Å

PDB Description: structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1dj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj2a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
igslsqvsgvlgcqwgdegkgklvdilaqhfdivarcqgganaghtiynsegkkfalhlv
psgilnedttcvigngvvvhlpglfkeidglesngvsckgrilvsdrahllfdfhqevdg
lreselaksfigttkrgigpaysskvirngirvgdlrhmdtlpqkldlllsdaaarfqgf
kytpemlreeveaykryadrlepyitdtvhfindsisqkkkvlveggqatmldidfgtyp
fvtssspsaggictglgiapsvvgdligvvkayttrvgsgpfptenlgtggdllrlagqe
fgtttgrprrcgwldivalkfscqingfaslnltkldvlsdlneiqlgvaykrsdgtpvk
sfpgdlrlleelhveyevlpgwksdissvrnysdlpkaaqqyverieelvgvpihyigig
pgrdaliyk

SCOPe Domain Coordinates for d1dj2a_ are not available.

Timeline for d1dj2a_:

Domains from other chains:
(mouse over for more information)
d1dj2b_