SCOPe 2.08: Domain d5t02b_: 5t02 B:

Lineage for d5t02b_ (5t02 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:272831] [193287] (8 PDB entries)

8. Domain d5t02b_: 5t02 B: [322364]
   automated match to d4iena_
   complexed with cl, coa, gdp; mutant

Details for d5t02b_

PDB Entry: 5t02, 2.8 Å

PDB Description: structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis

PDB Compounds: (B:) acyl-CoA hydrolase

SCOPe Domain Sequences for d5t02b_:

Sequence; same for both SEQRES and ATOM records:

>d5t02b_ d.38.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 272831]}
lpshelimselmmpdtanfsgnvhggelllllaqvayscasrysgnycvtlsvdkvlfke
pihigdlvtfyaavnytgrtsmeigirveaqnirtgeirhtnscyftmvavkdgkpvpvp
pleiltdrqrcryekakkrrdislqas

Timeline for d5t02b_:

• d5t02b_ first appeared in SCOPe 2.06
  
• d5t02b_ appears in SCOPe 2.07