SCOPe 2.08: Domain d4zmqa2: 4zmq A:102-213

Lineage for d4zmqa2 (4zmq A:102-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)

8. Domain d4zmqa2: 4zmq A:102-213 [322361]
   Other proteins in same PDB: d4zmqa3, d4zmqb3
   automated match to d1ff5a2
   complexed with 1pe, ca

Details for d4zmqa2

PDB Entry: 4zmq, 2.2 Å

PDB Description: crystal structure of human p-cadherin (ss-x-dimer)

PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d4zmqa2:

Sequence; same for both SEQRES and ATOM records:

>d4zmqa2 b.1.6.0 (A:102-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl
mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveild

Timeline for d4zmqa2:

• d4zmqa2 first appeared in SCOPe 2.06
  
• d4zmqa2 appears in SCOPe 2.07