Lineage for d5t06b_ (5t06 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187709Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2187816Protein automated matches [190155] (3 species)
    not a true protein
  7. 2187817Species Escherichia coli [TaxId:83334] [319369] (3 PDB entries)
  8. 2187823Domain d5t06b_: 5t06 B: [322342]
    automated match to d1s5uc_
    complexed with edo, hxc

Details for d5t06b_

PDB Entry: 5t06 (more details), 1.9 Å

PDB Description: crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa
PDB Compounds: (B:) Acyl-CoA thioester hydrolase ybgC

SCOPe Domain Sequences for d5t06b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t06b_ d.38.1.1 (B:) automated matches {Escherichia coli [TaxId: 83334]}
tlfrwpvrvyyedtaaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmt
veyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpra
lpksivaef

SCOPe Domain Coordinates for d5t06b_:

Click to download the PDB-style file with coordinates for d5t06b_.
(The format of our PDB-style files is described here.)

Timeline for d5t06b_: