| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
| Protein automated matches [190458] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries) |
| Domain d4zmtd2: 4zmt D:102-214 [322340] automated match to d1ff5a2 complexed with ca |
PDB Entry: 4zmt (more details), 2.7 Å
SCOPe Domain Sequences for d4zmtd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zmtd2 b.1.6.0 (D:102-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl
mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveilda
Timeline for d4zmtd2: