Lineage for d1adib_ (1adi B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847600Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1847601Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 1847602Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)
  8. 1847628Domain d1adib_: 1adi B: [32234]

Details for d1adib_

PDB Entry: 1adi (more details), 2.5 Å

PDB Description: structure of adenylosuccinate synthetase at ph 6.5 and 25 degrees celsius
PDB Compounds: (B:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1adib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adib_ c.37.1.10 (B:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOPe Domain Coordinates for d1adib_:

Click to download the PDB-style file with coordinates for d1adib_.
(The format of our PDB-style files is described here.)

Timeline for d1adib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1adia_