SCOPe 2.08: Domain d1nhta_: 1nht A:

Lineage for d1nhta_ (1nht A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
   common fold is interrupted by an all-alpha subdomain, residues 100-200

7. Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)

8. Domain d1nhta_: 1nht A: [32232]
   complexed with gdp, hda, mg, pgs
   has additional subdomain(s) that are not in the common domain

Details for d1nhta_

PDB Entry: 1nht, 2.5 Å

PDB Description: entrapment of 6-thiophosphoryl-imp in the active site of crystalline adenylosuccinate synthetase from escherichia coli data collected at 100k

PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1nhta_:

Sequence; same for both SEQRES and ATOM records:

>d1nhta_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

Timeline for d1nhta_:

• d1nhta_ first appeared (with stable ids) in SCOP 1.55, called d1nht__
  
• d1nhta_ appears in SCOPe 2.07