Lineage for d1ksz__ (1ksz -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) 
Protein Adenylosuccinate synthetase, PurA [52655] (3 species) Species Escherichia coli [TaxId:562] [52656] (20 PDB entries) 
Domain d1ksz__: 1ksz - [32231]
Details for d1ksz__
PDB Entry: 1ksz (more details), 2.8 Å
PDB Description: entrapment of 6-thiophosphoryl-imp in the active site of crystalline adenylosuccinate synthetase from escherichia coli, data collected at 298k
SCOP Domain Sequences for d1ksz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksz__ c.37.1.10 (-) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda
SCOP Domain Coordinates for d1ksz__:
Click to download the PDB-style file with coordinates for d1ksz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ksz__:
- d1ksz__ first appeared (with stable ids) in SCOP 1.55
- d1ksz__ appears in SCOP 1.59
- d1ksz__ appears in the current release, SCOPe 2.08, called d1ksza_
View in 3D