Lineage for d1soo__ (1soo -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69969Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 69970Protein Adenylosuccinate synthetase, PurA [52655] (3 species)
  7. 69974Species Escherichia coli [TaxId:562] [52656] (20 PDB entries)
  8. 69992Domain d1soo__: 1soo - [32229]

Details for d1soo__

PDB Entry: 1soo (more details), 2.6 Å

PDB Description: adenylosuccinate synthetase inhibited by hydantocidin 5'-monophosphate

SCOP Domain Sequences for d1soo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soo__ c.37.1.10 (-) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1soo__:

Click to download the PDB-style file with coordinates for d1soo__.
(The format of our PDB-style files is described here.)

Timeline for d1soo__: