Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [190915] (12 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [322282] (1 PDB entry) |
Domain d2n78a_: 2n78 A: [322283] automated match to d2n3sa_ |
PDB Entry: 2n78 (more details)
SCOPe Domain Sequences for d2n78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n78a_ b.40.4.5 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mskedsfemegtvvdtlpntmfrvelenghvvtahisgkmrknyiriltgdkvrveltpy dlskgrityrar
Timeline for d2n78a_: