Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
Protein automated matches [190155] (3 species) not a true protein |
Species Escherichia coli [TaxId:83334] [319369] (3 PDB entries) |
Domain d5t07d_: 5t07 D: [322281] automated match to d1s5uc_ complexed with mfk |
PDB Entry: 5t07 (more details), 1.72 Å
SCOPe Domain Sequences for d5t07d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t07d_ d.38.1.1 (D:) automated matches {Escherichia coli [TaxId: 83334]} ttlfrwpvrvyyedtaaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkm tveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpr alpksivaef
Timeline for d5t07d_: