SCOPe 2.05: Domain d1cg4a_: 1cg4 A:

Lineage for d1cg4a_ (1cg4 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
   common fold is interrupted by an all-alpha subdomain, residues 100-200

7. Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)

8. Domain d1cg4a_: 1cg4 A: [32228]
   complexed with gdp, imo, mg; mutant

Details for d1cg4a_

PDB Entry: 1cg4, 2.5 Å

PDB Description: structure of the mutant (r303l) of adenylosuccinate synthetase from e. coli complexed with, gdp, 6-phosphoryl-imp, and mg2+

PDB Compounds: (A:) protein (adenylosuccinate synthetase)

SCOPe Domain Sequences for d1cg4a_:

Sequence; same for both SEQRES and ATOM records:

>d1cg4a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tglrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

Timeline for d1cg4a_:

• d1cg4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cg4a_ appears in SCOPe 2.04
  
• d1cg4a_ appears in SCOPe 2.06
  
• d1cg4a_ appears in the current release, SCOPe 2.08