Lineage for d2n71a_ (2n71 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038555Family g.68.1.0: automated matches [254208] (1 protein)
    not a true family
  6. 3038556Protein automated matches [254463] (3 species)
    not a true protein
  7. 3038557Species Cenchritis muricatus [TaxId:197001] [322277] (1 PDB entry)
  8. 3038558Domain d2n71a_: 2n71 A: [322278]
    automated match to d2nu2i1

Details for d2n71a_

PDB Entry: 2n71 (more details)

PDB Description: nmr structure of cmpi-ii, a serin protease inhibitor isolated from mollusk cenchitis muricatus
PDB Compounds: (A:) Protease inhibitor 2

SCOPe Domain Sequences for d2n71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n71a_ g.68.1.0 (A:) automated matches {Cenchritis muricatus [TaxId: 197001]}
aedcvgrkactrewypvcgsdgvtysnpcnfsaqqeqcdpnitiahmgec

SCOPe Domain Coordinates for d2n71a_:

Click to download the PDB-style file with coordinates for d2n71a_.
(The format of our PDB-style files is described here.)

Timeline for d2n71a_: