| Class g: Small proteins [56992] (100 folds) |
| Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
| Family g.68.1.0: automated matches [254208] (1 protein) not a true family |
| Protein automated matches [254463] (3 species) not a true protein |
| Species Cenchritis muricatus [TaxId:197001] [322277] (1 PDB entry) |
| Domain d2n71a_: 2n71 A: [322278] automated match to d2nu2i1 |
PDB Entry: 2n71 (more details)
SCOPe Domain Sequences for d2n71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n71a_ g.68.1.0 (A:) automated matches {Cenchritis muricatus [TaxId: 197001]}
aedcvgrkactrewypvcgsdgvtysnpcnfsaqqeqcdpnitiahmgec
Timeline for d2n71a_: