Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Erythrobacter litoralis [TaxId:314225] [322270] (1 PDB entry) |
Domain d2n9ua1: 2n9u A:142-266 [322271] Other proteins in same PDB: d2n9ua2 automated match to d2fspa_ |
PDB Entry: 2n9u (more details)
SCOPe Domain Sequences for d2n9ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n9ua1 c.23.1.0 (A:142-266) automated matches {Erythrobacter litoralis [TaxId: 314225]} stnvliiedeplismqledlvrslghdiagtaatrtqaqeavakekpglvladiqladgs sgidavedilgqfdvpvifitayperlltgdrpeptylvtkpfqestvrttisqalffqn sptav
Timeline for d2n9ua1: