SCOPe 2.08: Domain d2n9ua1: 2n9u A:142-266

Lineage for d2n9ua1 (2n9u A:142-266)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Erythrobacter litoralis [TaxId:314225] [322270] (1 PDB entry)

8. Domain d2n9ua1: 2n9u A:142-266 [322271]
   Other proteins in same PDB: d2n9ua2
   automated match to d2fspa_

Details for d2n9ua1

PDB Entry: 2n9u

PDB Description: solution nmr structure of erythrobacter litoralis phyr response regulator rec domain

PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d2n9ua1:

Sequence; same for both SEQRES and ATOM records:

>d2n9ua1 c.23.1.0 (A:142-266) automated matches {Erythrobacter litoralis [TaxId: 314225]}
stnvliiedeplismqledlvrslghdiagtaatrtqaqeavakekpglvladiqladgs
sgidavedilgqfdvpvifitayperlltgdrpeptylvtkpfqestvrttisqalffqn
sptav

Timeline for d2n9ua1:

• d2n9ua1 first appeared in SCOPe 2.06
  
• d2n9ua1 appears in SCOPe 2.07