Lineage for d1son__ (1son -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23416Protein Adenylosuccinate synthetase, PurA [52655] (3 species)
  7. 23420Species Escherichia coli [TaxId:562] [52656] (20 PDB entries)
  8. 23436Domain d1son__: 1son - [32227]

Details for d1son__

PDB Entry: 1son (more details), 2.55 Å

PDB Description: adenylosuccinate synthetase in complex with the natural feedback inhibitor amp

SCOP Domain Sequences for d1son__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1son__ c.37.1.10 (-) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1son__:

Click to download the PDB-style file with coordinates for d1son__.
(The format of our PDB-style files is described here.)

Timeline for d1son__: