Lineage for d5kp3a_ (5kp3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936380Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. 2936462Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
    Uniprot P07445
  8. 2936547Domain d5kp3a_: 5kp3 A: [322258]
    automated match to d3t8nf_
    complexed with equ, so4

Details for d5kp3a_

PDB Entry: 5kp3 (more details), 1.7 Å

PDB Description: crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to equilenin; d40n, y57(cl-y)
PDB Compounds: (A:) steroid delta-isomerase

SCOPe Domain Sequences for d5kp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kp3a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafxrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
sevnlsv

SCOPe Domain Coordinates for d5kp3a_:

Click to download the PDB-style file with coordinates for d5kp3a_.
(The format of our PDB-style files is described here.)

Timeline for d5kp3a_: